PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00058621001
Common NameGSBRNA2T00058621001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 335aa    MW: 37918.2 Da    PI: 8.7038
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00058621001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.33.2e-32160213255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  GSBRNA2T00058621001 160 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 213
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.56E-15157213IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28158213IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-23160213IPR006447Myb domain, plants
PfamPF002492.1E-7161212IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PSSTSKTTNN HHHPLGDLSL SNNSHQHQQQ HQHPLLLPNC  60
NGSNILTSFQ FQTQQQQGFL AHDLNTHLRP IRGIPLYQNH HPHHHHRPPP PYFPFDPSSV  120
SNSGLITNPN YHNHQHHHHQ TLNRARFMPR FPAKRSMRAP RMRWTTTLHA RFVHAVELLG  180
GHERATPKSV LELMDVKDLT LAHVKSHLQM YRTVKTTDKA AASSGQSDVY ENGSSGDNNS  240
DDWMFDINRK SRDSDELMNP LEKSNGLWTN SSGEARLHGK LIDNVAEIML PSEKEIDGKC  300
SSYERISSEE RSLSSISGTS PFKPNLEFTL GRYH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00058621001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0486890.0AY048689.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI2 (KAN2) mRNA, complete cds.
GenBankBT0292110.0BT029211.1 Arabidopsis thaliana At1g32240 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013613867.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ9C6161e-164KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A078HCP60.0A0A078HCP6_BRANA; BnaA05g16290D protein
STRINGBra033844.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-128G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]